Antibodies

View as table Download

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-AOX1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Rabbit Polyclonal Anti-PDXK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the N terminal of human PDXK. Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK

Rabbit polyclonal anti-AOX1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOX1

Rabbit polyclonal anti-AOX1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOX1

Special Offer: Get this product for $99/€99. Use code: "Truesample".