Antibodies

Jump to Filters
View as table Download
GRK7 Rabbit Polyclonal Antibody
TA316104

USD 380.00

4 Weeks

Rabbit polyclonal anti-GRK7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRK7.
GRK7 Rabbit Polyclonal Antibody
TA342751

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRK7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK7 antibody: synthetic peptide directed towards the C terminal of human GRK7. Synthetic peptide located within the following region: FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL