Antibodies

Jump to Filters
View as table Download
ORC6L (ORC6) Goat Polyclonal Antibody
TA311416

USD 520.00

5 Days

Goat Anti-ORC6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENAASAQKATAE, from the C Terminus of the protein sequence according to NP_055136.1.
ORC6L (ORC6) Rabbit Polyclonal Antibody
TA334514

USD 539.00

5 Days

Rabbit Polyclonal Anti-ORC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORC6 antibody is: synthetic peptide directed towards the N-terminal region of Human ORC6. Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS
ORC6L (ORC6) Rabbit Polyclonal Antibody
TA334515

USD 539.00

5 Days

Rabbit Polyclonal Anti-ORC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORC6 antibody: synthetic peptide directed towards the C terminal of human ORC6. Synthetic peptide located within the following region: VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE