TFDP2 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TFDP2 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TFDP2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFDP2 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFDP2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TFDP2 mouse monoclonal antibody,clone OTI4C11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
TFDP2 mouse monoclonal antibody,clone OTI4C11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
TFDP2 mouse monoclonal antibody,clone OTI7B6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
TFDP2 mouse monoclonal antibody,clone OTI7B6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-TFDP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-TFDP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF |
TFDP2 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-TFDP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TFDP2 antibody is: synthetic peptide directed towards the C-terminal region of Human TFDP2. Synthetic peptide located within the following region: SVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDE |
TFDP2 mouse monoclonal antibody,clone OTI7B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".