Rabbit polyclonal COT (Ab-290) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Rabbit polyclonal MAP3K8 (Ab-400) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D). |
Rabbit Polyclonal COT Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human COT |
Rabbit Polyclonal COT (Thr290) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human COT around the phosphorylation site of Threonine 290 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-MAP3K8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the C terminal of human MAP3K8. Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY |
Rabbit Polyclonal anti-MAP3K8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the N terminal of human MAP3K8. Synthetic peptide located within the following region: ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL |
Rabbit polyclonal MAP3K8 (Ser400) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
