Antibodies

Jump to Filters
View as table Download
LBP Rabbit Polyclonal Antibody
TA308490

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to LBP (lipopolysaccharide binding protein)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 467 of LBP (Uniprot ID#P18428)
LBP Rabbit Polyclonal Antibody
TA346104

USD 539.00

5 Days

Rabbit Polyclonal Anti-LBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV
LBP Rabbit Polyclonal Antibody
TA346105

USD 539.00

5 Days

Rabbit Polyclonal Anti-LBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LBP antibody: synthetic peptide directed towards the C terminal of human LBP. Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL