Rabbit Polyclonal Anti-ADORA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADORA1 antibody: synthetic peptide directed towards the C terminal of human ADORA1. Synthetic peptide located within the following region: THGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD |
Rabbit Polyclonal Anti-ADORA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADORA1 antibody: synthetic peptide directed towards the C terminal of human ADORA1. Synthetic peptide located within the following region: VLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLAL |
Rabbit polyclonal anti-ADORA1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ADORA1. |
Germany
Japan
United Kingdom
China
