Rabbit Polyclonal Anti-ZFPL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFPL1 Antibody: synthetic peptide directed towards the middle region of human ZFPL1. Synthetic peptide located within the following region: NGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNT |
Rabbit Polyclonal Anti-ZFPL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFPL1 antibody: synthetic peptide directed towards the middle region of human ZFPL1. Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS |
Germany
Japan
United Kingdom
China
