Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAPK11 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK11 |
| Modifications | Unmodified |
MAPK11 mouse monoclonal antibody, clone 4H6H6, Ascites
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAPK11 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human P38beta C-term Antibody. |
MAPK11 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human P38beta. |
Rabbit polyclonal Anti-Mapk11 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mapk11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mapk11. Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY |
MAPK11 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human MK11 |
MAPK11 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human MAPK11 |
Active filters
Filter by
Reactivities
Antibody Hosts
Clonalities
Carrier-free
Modifications
Families
Pathways
- Amyotrophic lateral sclerosis (ALS) (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Fc epsilon RI signaling pathway (6)
- GnRH signaling pathway (6)
- Leukocyte transendothelial migration (6)
- MAPK signaling pathway (6)
- NOD-like receptor signaling pathway (6)
- Neurotrophin signaling pathway (6)
- Progesterone-mediated oocyte maturation (6)
- RIG-I-like receptor signaling pathway (6)
- T cell receptor signaling pathway (6)
- Toll-like receptor signaling pathway (6)
- VEGF signaling pathway (6)