Antibodies

Jump to Filters
View as table Download
C20orf103 (LAMP5) Rabbit Polyclonal Antibody
TA341902

USD 539.00

5 Days

Rabbit Polyclonal Anti-C20orf103 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C20orf103 antibody: synthetic peptide directed towards the middle region of human C20orf103. Synthetic peptide located within the following region: CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE
C20orf103 (LAMP5) Rabbit Polyclonal Antibody
TA360868

USD 539.00

5 Days

LAMP5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C20ORF103