Rabbit Polyclonal Anti-SFRS10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10. Synthetic peptide located within the following region: MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKS |
Rabbit Polyclonal Anti-SFRS10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD |
TRA2B (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 207-237 amino acids from the Central region of human TRA2B |
TRA2B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRA2B |
Germany
Japan
United Kingdom
China
