Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
DLL1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 573-723 of human DLL1 (NP_005609.3). |
| Modifications | Unmodified |
Goat Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat (Expected from sequence similarity: Human) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
Delta-like protein 1 (155-173) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acids 155-173 of Mouse DELTA-1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- DLL1
Conjugates
- Unconjugated