Antibodies

Jump to Filters
View as table Download
VCP Rabbit Polyclonal Antibody
TA890028

USD 407.00

In Stock

Rabbit polyclonal anti-VCP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VCP
VCP Rabbit Polyclonal Antibody
TA365438

USD 380.00

4 Weeks

VCP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human VCP
VCP Rabbit Polyclonal Antibody
TA369754

USD 380.00

4 Weeks

VCP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human VCP
VCP Rabbit Monoclonal Antibody [Clone ID: R06-9D7]
TA385544

USD 380.00

4 Weeks

VCP Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
VCP Rabbit Polyclonal Antibody
TA383207

USD 365.00

3 Weeks

VCP Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 647-806 of human VCP (NP_009057.1).
Modifications Unmodified
VCP Rabbit Polyclonal Antibody
TA321800

USD 380.00

4 Weeks

Anti-VCP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 792-806 amino acids of human valosin containing protein
VCP Rabbit Polyclonal Antibody
TA342593

USD 539.00

5 Days

Rabbit Polyclonal Anti-VCP Antibody

Applications IP, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-VCP antibody: synthetic peptide directed towards the C terminal of human VCP. Synthetic peptide located within the following region: EMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLY
VCP Rabbit Polyclonal Antibody
AP21142PU-N

USD 465.00

3 Weeks

VCP rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
VCP Rabbit Polyclonal Antibody
TA385543

USD 380.00

4 Weeks

VCP Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human VCP
VCP Rabbit Polyclonal Antibody
TA312335

USD 380.00

In Stock

Rabbit polyclonal VCP (Ser784) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VCP around the phosphorylation site of serine 784.
Modifications Phospho-specific
VCP Goat Polyclonal Antibody
TA329667

USD 520.00

5 Days

Goat Anti-CDC48/ VCP / YDL126C (baker's yeast, aa128-142) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Dog, Cow, Saccharomyces cerevisiae
Conjugation Unconjugated
Immunogen Peptide with sequence C-PIADTIEGITGNLFD, from the internal region of the protein sequence according to NP_010157.1
VCP Goat Polyclonal Antibody
TA329668

USD 520.00

5 Days

Goat Anti-CDC48 / VCP / YDL126C Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Dog, Cow, Saccharomyces cerevisiae
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTKNMKLADDVDLE, from the internal region of the protein sequence according to NP_010157.1
VCP Mouse Monoclonal Antibody [Clone ID: 58.13.3]
BM5518

USD 420.00

2 Weeks

VCP mouse monoclonal antibody, clone 58.13.3, Supernatant

Applications WB
Reactivities Human, Rabbit, Rat, Xenopus
Conjugation Unconjugated