Antibodies

Jump to Filters
View as table Download
TRAF1 Rabbit Polyclonal Antibody
TA324109

USD 380.00

In Stock

Anti-TRAF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 182-412 amino acids of human TNF receptor-associated factor 1
TRAF1 Goat Polyclonal Antibody
TA303092

USD 520.00

5 Days

Goat Polyclonal Antibody against TRAF1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLQSPKHAYVKDD, from the C Terminus of the protein sequence according to NP_005649.1.
TRAF1 Rabbit Polyclonal Antibody
TA330395

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAF1 antibody: synthetic peptide directed towards the middle region of human TRAF1. Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK