F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
F2 mouse monoclonal antibody,clone OTI5G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-F2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Rabbit Polyclonal Anti-F2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human F2 |
F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
F2 mouse monoclonal antibody,clone OTI5G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Prothrombin / THRB (AP2, Cleaved-Arg327) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human THRB. |
Rabbit Polyclonal Anti-THRB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |