ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALG2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase |
Anti-ALG2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase |
ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALG2 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the C terminal of human ALG2 |
Rabbit Polyclonal Anti-ALG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC |
ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".