Antibodies

View as table Download

ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALG2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase

Anti-ALG2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase

ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALG2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the C terminal of human ALG2

Rabbit Polyclonal Anti-ALG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC