SGCD mouse monoclonal antibody,clone OTI3D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SGCD mouse monoclonal antibody,clone OTI3D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SGCD mouse monoclonal antibody,clone OTI3D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SGCD mouse monoclonal antibody,clone OTI3D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 430.00
3 Weeks
delta Sarcoglycan (SGCD) mouse monoclonal antibody, clone AT19G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 315.00
3 Weeks
delta Sarcoglycan (SGCD) mouse monoclonal antibody, clone AT19G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-Delta-Sarcoglycan (aa245-257) Antibody
Applications | WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RLPHGSYTPTGTR, from the internal region of the protein sequence according to NP_000328.2; NP_758447.1; NP_001121681.1. |
Rabbit Polyclonal Anti-Sgcd Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sgcd antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ |