Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211) |
Rabbit polyclonal GSTP1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
Rabbit Polyclonal Anti-GSTP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTP1 antibody is: synthetic peptide directed towards the N-terminal region of Human GSTP1. Synthetic peptide located within the following region: TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ |
GST3 (GSTP1) rabbit polyclonal antibody, Serum
| Applications | ELISA, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Glutathion S-Transferase pi |
GST3 (GSTP1) rabbit polyclonal antibody, Serum
| Applications | ELISA, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Glutathion S-Transferase pi |
GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide mapping at the C-terminus of GSTpi of human origin |
Rabbit anti-GSTP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GSTP1 |
Active filters
Category
- Antibodies
Target Symbol
- GST3
Reactivities
- Human
Conjugates
- Unconjugated
Pathways
- Glutathione metabolism