Antibodies

Jump to Filters
View as table Download
CYC1 (C-term) Rabbit Polyclonal Antibody
AP51160PU-N

USD 580.00

2 Weeks

CYC1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 270-299aa) of human Cytochrome C1/ CYC1.
CYC1 Rabbit Polyclonal Antibody
TA340034

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP
CYC1 Rabbit Polyclonal Antibody
TA359617

USD 539.00

5 Days

CYC1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYC1
CYC1 Rabbit Polyclonal Antibody
TA313717

USD 380.00

In Stock

Rabbit polyclonal anti-CYC1 antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYC1.