Rabbit Polyclonal Anti-ACSM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the C terminal of human ACSM3. Synthetic peptide located within the following region: DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW |
Rabbit Polyclonal Anti-ACSM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSM3 Antibody is: synthetic peptide directed towards the middle region of Human ACSM3. Synthetic peptide located within the following region: EPITPDVTEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPS |
Rabbit Polyclonal Anti-ACSM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the N terminal of human ACSM3. Synthetic peptide located within the following region: SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR |
Germany
Japan
United Kingdom
China