USD 447.00
In Stock
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 447.00
In Stock
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) ADSL mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 200.00
2 Days
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ADSL Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adenylosuccinate lyase |
Rabbit Polyclonal Anti-ADSL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI |
ADSL Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADSL |