Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against MMP7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKLYGKRSNSRKK, from the C Terminus of the protein sequence according to NP_002414.1. |
Antibodies
View as table Download
Rabbit anti-MMP7 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP7 |
Anti-MMP7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 5-100 amino acids of human matrix metallopeptidase 7 (matrilysin, uterine) |
Rabbit Polyclonal MMP-7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human MMP7 protein (between residues 250-300) [UniProt P09237] |
Rabbit Polyclonal Anti-MMP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK |
Rabbit Polyclonal Anti-MMP7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7 |
Rabbit anti MMP-7 (Matrilysin) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human MMP-7. This sequence is identical among bovine and monkey. |
MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
- Antibodies
Target Symbol
- MMP7
Conjugates
- Unconjugated
Pathways
- Wnt signaling pathway