Rabbit Polyclonal antibody to RACGAP1 (Rac GTPase activating protein 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RACGAP1 (Uniprot ID#Q9H0H5) |
Goat Polyclonal Antibody against RACGAP1 / MgcRacGAP
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GRQGNFFASPMLK, from the C Terminus of the protein sequence according to NP_037409.1. |
Rabbit Polyclonal GTPase Activating Protein Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein |
Rabbit Polyclonal GTPase Activating Protein (Ser387) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein around the phosphorylation site of Serine 387 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RACGAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: EILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALD |
Rabbit Polyclonal Anti-RACGAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: KREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGG |
Rabbit Polyclonal Anti-CBFA2T2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the middle region of human CBFA2T2. Synthetic peptide located within the following region: GQGRPLLPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNG |
Rabbit Polyclonal Anti-Racgap1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF |
Germany
Japan
United Kingdom
China
