Antibodies

View as table Download

Rabbit Polyclonal Anti-ARFGAP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARFGAP1

Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE

Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: GQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFL

ARFGAP1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARFGAP1

ARFGAP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ARFGAP1 (NP_001268411.1).
Modifications Unmodified