Antibodies

View as table Download

Rabbit Polyclonal Anti-MYH1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MYH1

Rabbit Polyclonal Anti-MYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK