Antibodies

Jump to Filters
View as table Download
p53 (TP53) Rabbit Polyclonal Antibody
TA327567

USD 365.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53
p53 (TP53) Goat Polyclonal Antibody
AB0154-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
p53 (TP53) Rabbit Polyclonal Antibody
TA324776

USD 580.00

5 Days

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Monkey, Rabbit)
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific
p53 (TP53) Goat Polyclonal Antibody
AB0065-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
p53 (TP53) Rabbit Polyclonal Antibody
TA326192

USD 380.00

In Stock

Rabbit polyclonal p53 (Ab-378) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).
p53 (TP53) Rabbit Polyclonal Antibody
TA354205

USD 370.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354509

USD 395.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354572

USD 425.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA342298

USD 485.00

5 Days

Rabbit Polyclonal Anti-TRP53 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR
p53 (TP53) Rabbit Polyclonal Antibody
TA325951

USD 380.00

In Stock

Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20
Modifications Phospho-specific
p53 (TP53) Rabbit Polyclonal Antibody
TA326103

USD 380.00

In Stock

Rabbit polyclonal p53 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p53.
p53 (TP53) Rabbit Polyclonal Antibody
TA325948

USD 380.00

4 Weeks

Rabbit Polyclonal p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53
p53 (TP53) Rabbit Polyclonal Antibody
TA347816

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53
p53 (TP53) Rabbit Polyclonal Antibody
TA347810

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53
p53 (TP53) Rabbit Polyclonal Antibody
TA347818

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53