Antibodies

Jump to Filters
View as table Download
NDUFA3 Rabbit Polyclonal Antibody
TA314234

USD 380.00

In Stock

Rabbit polyclonal anti-NDUFA3 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA3.
NDUFA3 Rabbit Polyclonal Antibody
TA350213

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA3
NDUFA3 Rabbit Polyclonal Antibody
TA343224

USD 539.00

5 Days

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufa3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ndufa3. Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL