Antibodies

Jump to Filters
View as table Download
NDUFA8 Rabbit Polyclonal Antibody
TA351430

USD 380.00

In Stock

Rabbit Polyclonal Anti-NDUFA8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NDUFA8
NDUFA8 Rabbit Polyclonal Antibody
TA314236

USD 380.00

In Stock

Rabbit polyclonal anti-NDUFA8 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA8.
NDUFA8 Rabbit Polyclonal Antibody
TA343216

USD 539.00

5 Days

Rabbit Polyclonal Anti-NDUFA8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufa8 antibody is: synthetic peptide directed towards the middle region of Mouse Ndufa8. Synthetic peptide located within the following region: KEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLD