Antibodies

Jump to Filters
View as table Download
OR5AP2 Rabbit Polyclonal Antibody
TA316342

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR5AP2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR5AP2.
OR5AP2 Rabbit Polyclonal Antibody
TA337516

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR5AP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5AP2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5AP2. Synthetic peptide located within the following region: MYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKNKDVKKALKKILWK