Antibodies

Jump to Filters
View as table Download
Prothrombin (F2) Rabbit Polyclonal Antibody
TA351802

USD 380.00

In Stock

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346199

USD 539.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR
Prothrombin (F2) Rabbit Polyclonal Antibody
TA347556

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB