Antibodies

Jump to Filters
View as table Download
Somatostatin Receptor 2 (SSTR2) Rabbit Polyclonal Antibody
TA321271

USD 380.00

4 Weeks

Anti-SSTR2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2
Somatostatin Receptor 2 (SSTR2) Rabbit Polyclonal Antibody
TA321272

USD 380.00

In Stock

Anti-SSTR2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2
Somatostatin Receptor 2 (SSTR2) Rabbit Polyclonal Antibody
TA342653

USD 539.00

5 Days

Rabbit Polyclonal Anti-SSTR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SSTR2 antibody: synthetic peptide directed towards the middle region of human SSTR2. Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL