Antibodies

Jump to Filters
View as table Download
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA335038

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNAI2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the C terminal of human GNAI2. Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA335037

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNAI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the middle region of human GNAI2. Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL