Antibodies

Jump to Filters
View as table Download
G protein alpha inhibitor 1 (GNAI1) Rabbit Polyclonal Antibody
TA335036

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNAI1 Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) Rabbit Polyclonal Antibody
AP05163PU-N

USD 580.00

5 Days

G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2.