Antibodies

Jump to Filters
View as table Download
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA327205

USD 365.00

3 Weeks

POLR2I Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLR2I
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA339121

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR2I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: ACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQ
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA343591

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR2I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS