Antibodies

Jump to Filters
View as table Download
Iduronate 2 sulfatase (IDS) Goat Polyclonal Antibody
TA305799

USD 520.00

In Stock

Goat Anti-IDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1.
Iduronate 2 sulfatase (IDS) Rabbit Polyclonal Antibody
TA343089

USD 539.00

5 Days

Rabbit Polyclonal Anti-IDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDS antibody: synthetic peptide directed towards the N terminal of human IDS. Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE