Antibodies

View as table Download

Rabbit Polyclonal Anti-GPRC6A Antibody (N-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Monkey (94%), Marmoset (89%), Mouse (89%), Rat (89%), Bat (89%), Elephant (89%), Hamster (83%), Panda (83%), Horse (83%), Pig (83%).

GPRC6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey (Predicted: Dog, Horse, Pig, Rabbit)
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Panda (100%); Dog, Elephant, Rabbit, Horse, Pig (94%); Marmoset, Mouse, Rat, Bovine, Hamster (82%).

Rabbit polyclonal antibody to GPRC6A (G protein-coupled receptor, family C, group 6, member A)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 862 and 926 of GPRC6A (Uniprot ID#Q5T6X5)

Rabbit polyclonal anti-GPC6A antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPC6A.

GPRC6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human (Predicted: Rat, Hamster, Rabbit)
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Rat, Hamster, Rabbit (93%); Monkey, Marmoset, Mouse, Dog, Elephant, Panda, Horse (86%).

Rabbit Polyclonal Anti-GPRC6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPRC6A antibody is: synthetic peptide directed towards the N-terminal region of Human GPRC6A. Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE

GPRC6A (N-term) rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

GPRC6A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated