Rabbit Polyclonal Anti-NTSR1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | NTSR1 / NTR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human NTSR1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Panda, Dog, Horse (88%). |
Rabbit Polyclonal Anti-Neurotensin Receptor 1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide EQNRSADGQHAGGLVC corresponding to amino acid residues 209-224 of human Neurotensin Receptor 1. 2nd extracellular loop. |
Rabbit Polyclonal Anti-NTSR1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NTSR1 / NTR antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human NTSR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Elephant (94%); Marmoset (89%); Hamster (83%). |
USD 370.00
2 Weeks
Neurotensin Receptor 1 (NTSR1) mouse monoclonal antibody, clone B-N6, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Anti-NTSR1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 402-418 amino acids of Human neurotensin receptor 1 (high affinity) |
USD 335.00
2 Weeks
Neurotensin Receptor 1 (NTSR1) mouse monoclonal antibody, clone B-N6, Purified
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-NTR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NTR1. |
NTSR1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NTSR1 |
Germany
Japan
United Kingdom
China
