Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ACSL5 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ACSL5 mouse monoclonal antibody,clone OTI1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACSL5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG |
ACSL5 mouse monoclonal antibody,clone OTI3A3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ACSL5 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ACSL5 mouse monoclonal antibody,clone OTI1C6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit anti-ACSL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACSL5 |
Goat Polyclonal Antibody against ACSL5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RTQIDSLYEHIQD, from the C Terminus of the protein sequence according to NP_057318.2; NP_976313.1; NP_976314.1. |
ACSL5 mouse monoclonal antibody,clone OTI1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ACSL5
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Metabolic pathways