Antibodies

Jump to Filters
View as table Download
CYP4F3 (N-term) Rabbit Polyclonal Antibody
AP17978PU-N

USD 580.00

2 Weeks

CYP4F3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CYP4F3
LTC4S (N-term) Rabbit Polyclonal Antibody
AP18104PU-N

USD 580.00

2 Weeks

LTC4S (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human LTC4S
GGT7 Rabbit Polyclonal Antibody
TA331009

USD 539.00

5 Days

Rabbit polyclonal Anti-GGTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC
PTGIS Rabbit Polyclonal Antibody
TA335273

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTGIS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS
CYP4A22 Rabbit Polyclonal Antibody
TA346248

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS
Cytochrome p450 2J2 (CYP2J2) Rabbit Polyclonal Antibody
TA347754

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cytochrome P450 2J2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2J2 Antibody: A synthesized peptide derived from human Cytochrome P450 2J2
CYP2U1 Rabbit Polyclonal Antibody
TA357998

USD 539.00

5 Days

CYP2U1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Cytochrome P450 4A (CYP4A11) Rabbit Polyclonal Antibody
TA361947

USD 539.00

5 Days

CYP4A11 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CYP4A11
GGT1 Rabbit Polyclonal Antibody
TA361998

USD 539.00

5 Days

GGT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human GGT1
CYP2U1 Rabbit Polyclonal Antibody
TA362103

USD 539.00

5 Days

CYP2U1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP2U1
Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody [Clone ID: OTI5C9]
TA503482S

USD 200.00

In Stock

CYP2J2 (Cytochrome p450 2J2) mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody [Clone ID: OTI4B9]
TA503515S

USD 200.00

2 Days

CYP2J2 (Cytochrome p450 2J2) mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody [Clone ID: OTI3A7]
TA503516S

USD 200.00

2 Days

CYP2J2 (Cytochrome p450 2J2) mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".