Antibodies

View as table Download

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human, Dog, Rat, Monkey
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".