Antibodies

Jump to Filters
View as table Download
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA314192

USD 380.00

In Stock

Rabbit polyclonal anti-MGST1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MGST1.
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA342917

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-MGST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGST1 antibody: synthetic peptide directed towards the N terminal of human MGST1. Synthetic peptide located within the following region: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA354318

USD 425.00

5 Days

Rabbit anti GST Polyclonal Antibody

Applications WB
Conjugation Unconjugated
Immunogen A full length of GST recombinant protein.