Antibodies

Jump to Filters
View as table Download
Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody
TA321902

USD 380.00

In Stock

Anti-ADIPOR2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 11-24 amino acids of human adiponectin receptor 2
Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody
TA321903

USD 380.00

In Stock

Anti-ADIPOR2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 11-24 amino acids of human adiponectin receptor 2
Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody
TA343073

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ADIPOR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADIPOR2 antibody: synthetic peptide directed towards the N terminal of human ADIPOR2. Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK