Rabbit Polyclonal Antibody against CDC2 (C-term)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2. |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
CDK1 mouse monoclonal antibody, clone IMD-34, Purified
| Applications | IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China