PNLIP mouse monoclonal antibody,clone OTI5B9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PNLIP mouse monoclonal antibody,clone OTI5B9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PNLIP mouse monoclonal antibody,clone OTI9A9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNLIP mouse monoclonal antibody,clone OTI9A9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PNLIP mouse monoclonal antibody,clone OTI5B9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PNLIP |
Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Pig, Rabbit, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233) |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |
PNLIP mouse monoclonal antibody,clone OTI9A9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PNLIP mouse monoclonal antibody,clone OTI5B9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ |
Pancreatic Lipase (PNLIP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 311-341 amino acids from the C-terminal region of human Pancreatic lipase / PNLIP |