FOLR1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human recombinant protein fragment of human FOLR1 ( NP_057937 ) produced in HEK293T. |
FOLR1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human recombinant protein fragment of human FOLR1 ( NP_057937 ) produced in HEK293T. |
Rabbit polyclonal FOLR1 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1. |
Rabbit Polyclonal Anti-FOLR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOLR1 antibody: synthetic peptide directed towards the middle region of human FOLR1. Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF |
Rabbit polyclonal Aggrecan (Cleaved-Asp369) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Aggrecan. |
Rabbit polyclonal anti-FOLR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOLR1. |
FOLR1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human recombinant protein fragment of human FOLR1 ( NP_057937 ) produced in HEK293T. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".