Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Chk2 (Thr383) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 383 (M-R-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDK1/CDC2 (Thr14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDK1/CDC2 around the phosphorylation site of threonine 14 (E-G-TP-Y-G). |
| Modifications | Phospho-specific |
Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Chk2 (Thr387) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 387 (C-G-TP-P-T). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Active filters
Category
- Antibodies
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Protein Kinase
Pathways
- p53 signaling pathway