Germany
Japan
United Kingdom
China
MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
MASP2 mouse monoclonal antibody,clone OTI4D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI7D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI4D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI7D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-MASP2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MASP2. |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit Polyclonal Anti-Masp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- MASP2
Conjugates
- Unconjugated
Families
- Protease