Antibodies

Jump to Filters
View as table Download
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA308573

USD 625.00

5 Days

Rabbit polyclonal antibody to Cathepsin S (cathepsin S)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 32 and 265 of Cathepsin S (Uniprot ID#P25774)
Cathepsin S (CTSS) Mouse Monoclonal Antibody [Clone ID: AT1F9]
AM50049PU-S

USD 315.00

3 Weeks

Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Cathepsin S (CTSS) Mouse Monoclonal Antibody [Clone ID: AT1F9]
AM50049PU-N

USD 430.00

3 Weeks

Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA343088

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CTSS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
AP17262PU-N

USD 580.00

2 Weeks

Cathepsin S (CTSS) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CTSS
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA361305

USD 539.00

5 Days

CTSS Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CTSS