Antibodies

Jump to Filters
View as table Download
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI5B5]
TA503480S

USD 200.00

In Stock

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA332850

USD 365.00

3 Weeks

Rabbit anti-PSMB4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMB4
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA342167

USD 539.00

5 Days

Rabbit polyclonal Anti-PSMB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA342168

USD 539.00

5 Days

Rabbit polyclonal Anti-PSMB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI7B4]
TA503481S

USD 200.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI7B4 (formerly 7B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI1B6]
TA503557S

USD 200.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI1F8]
TA503637S

USD 200.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
TA504090S

USD 200.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI6F10]
TA503617S

USD 200.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".