Antibodies

View as table Download

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Anti-MME Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase

Rabbit Polyclonal Anti-ACE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACE

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP

Rabbit polyclonal Neprilysin Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Rabbit)
Conjugation Unconjugated
Immunogen This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin.

Rabbit Polyclonal Aminopeptidase A/APA Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal CTSA / PPGB (32k, Cleaved-Arg326) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PPGB

Rabbit Polyclonal Anti-CMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA

Goat Polyclonal Antibody against ENPEP

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQYQKTSLAQEKEK, from the internal region of the protein sequence according to NP_001968.2.

Anti-MME Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase

Rabbit polyclonal MME Antibody (Center)

Applications IF, WB
Reactivities Human, Mouse (Predicted: Rat)
Conjugation Unconjugated
Immunogen This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME.

Rabbit Polyclonal LNPEP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen LNPEP antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human LNPEP.

Rabbit polyclonal MME Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME.

Anti-CTSG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G

Anti-ACE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme